WWW.MASH.DOBROTA.BIZ
БЕСПЛАТНАЯ  ИНТЕРНЕТ  БИБЛИОТЕКА - онлайн публикации
 

«РЕГУЗОВА Ална Юрьевна Исследование специфической активности полиэпитопных Т-клеточных ВИЧ-1 иммуногенов, полученных с использованием различных стратегий проектирования ...»

На правах рукописи

РЕГУЗОВА

Ална Юрьевна

Исследование специфической активности

полиэпитопных Т-клеточных ВИЧ-1 иммуногенов,

полученных с использованием различных стратегий

проектирования

03.01.03 – молекулярная биология

АВТОРЕФЕРАТ

диссертации на соискание ученой степени

кандидата биологических наук

Кольцово – 2015

Работа выполнена в Федеральном бюджетном учреждении науки

«Государственный научный центр вирусологии и биотехнологии «Вектор» .

Карпенко Лариса Ивановна, доктор биологических Научные наук, заведующая лабораторией рекомбинантных руководители:

вакцин ФБУН Государственного научного центра вирусологии и биотехнологии «Вектор»

Бажан Сергей Иванович, доктор биологических наук, заведующий теоретическим отделом ФБУН Государственного научного центра вирусологии и биотехнологии «Вектор»

Дейнеко Елена Викторовна, доктор биологических Официальные наук, профессор, заведующая лабораторией оппоненты:

биоинженерии растений ФГБУН Института цитологии и генетики СО РАН Шаповал Андрей Иванович, кандидат биологических наук, директор РоссийскоАмериканского противоракового центра Алтайского Государственного Университета Федеральное государственное бюджетное Ведущая учреждение «Государственный научный центр организация:



«Институт иммунологии» Федерального медикобиологического агенства России 900 часов

Защита состоится «05» июня 2015 г. в на заседании диссертационного совета Д 208.020.01 при ФБУН Государственный научный центр вирусологии и биотехнологии «Вектор» по адресу: р.п. Кольцово, Новосибирского района, Новосибирской области, 630559, тел. 8(383) 336-74-28.

С диссертацией можно ознакомиться в библиотеке и на сайте Государственного научного центра вирусологии и биотехнологии «Вектор»

http://www.vector.nsc.ru

Автореферат разослан « » 2015 г .

Ученый секретарь диссертационного совета, доктор биологических наук, профессор В.А. Белявская

ОБЩАЯ ХАРАКТЕРИСТИКА РАБОТЫ

Актуальность исследования Современная антиретровирусная терапия позволяет снижать вирусную нагрузку у ВИЧ-инфицированных больных, замедляет прогрессирование инфекции и ее переход в стадию СПИДа, но не приводит к полной элиминации вируса (Shen and Siliciano, 2008; Chomont et al., 2009). В связи с этим задача создания вакцины против вируса иммунодефицита человека (ВИЧ) чрезвычайно актуальна. Первые положительные результаты получены в клинических испытаниях комбинированной вакцины против ВИЧ-1 RV144, в которых вакцина оказалась на 31,2 % эффективнее по сравнению с плацебо (Rerks-Ngarm et al., 2009). Основные выводы из этих испытаний заключались в том, что вакцину против ВИЧ создать можно, но необходимо проводить работу над повышением ее эффективности .

Рациональный дизайн вакцины должен быть направлен на формирование ВИЧ-специфических антител и CD8+ цитотоксических Т-лимфоцитов (ЦТЛ) против широкого спектра изолятов ВИЧ-1. В связи с этим на первый план выходят альтернативные технологии дизайна иммуногенов. Одним из таких подходов является получение искусственных полиэпитопных конструкций, которые включают в свой состав только эпитопы, необходимые для стимуляции протективного иммунного ответа (McMichael and Haynes, 2012) .



В данной работе будут рассматриваться вопросы, связанные с созданием только полиэпитопных Т-клеточных иммуногенов. Идея создания Т-клеточных вакцин против ВИЧ-1 основана на данных, согласно которым CD8+ ЦТЛ являются эффективными медиаторами противовирусного иммунного ответа (Mudd et al., 2012). В данном контексте создание искусственных полиэпитопных иммуногенов, стимулирующих антиген-специфический ответ CD8+ ЦТЛ, является перспективной стратегией для разработки вакцины против ВИЧ-1 (Koup and Douek, 2011). В настоящее время опубликовано достаточно много работ, посвященных конструированию и исследованию специфической активности искусственных полиэпитопных Т-клеточных иммуногенов (Berzofsky et al., 2001; Bazhan et al., 2004; 2010; Belyakov et al., 2004; 2006; 2007; 2012; Fischer et al. 2007; Karpenko et al., 2007; Ahlers and Belyakov, 2010; Rosario et al., 2010; Knudsen et al., 2012;

McMichael and Haynes, 2012). В то же время остается много нерешенных вопросов, связанных с выбором оптимальных стратегий проектирования полиэпитопных конструкций. Прогресс в определении CD4+ и CD8+ Т-клеточных эпитопов ВИЧ-1 и понимание особенностей процессинга эндогенно синтезирующихся антигенов по пути главного комплекса гистосовместимости (MHC) I и MHC II классов дает основу для дизайна полиэпитопных вакцин, индуцирующих ВИЧ-специфический Т-клеточный ответ .

Для создания эффективной Т-клеточной вакцины против ВИЧ необходимо применять не только рациональные подходы к конструированию, но и современные информативные методы для оценки Т-клеточного ответа. Появление технологии пептид-МНС-мультимеров предоставляет исследователям возможность визуализировать ВИЧ-специфические Т-лимфоциты, определять их количество в образце и проводить их последующий анализ на уровне одной клетки .

Использование пептид-МНС-мультимеров в комбинации с другими методами фенотипической и функциональной оценки Т-клеток позволяет детально охарактеризовать клеточный ответ в результате вакцинации и в дальнейшем определить параметры протективной иммунной защиты от ВИЧ .

Цель и задачи исследования Цель работы: провести исследование специфической активности полиэпитопных вакцинных конструкций против ВИЧ-1, спроектированных с учетом особенностей процессинга и презентации Т-клеточных антигенов, а также изучение формирования ВИЧ-специфических CD8+ T-лимфоцитов с помощью метода пептид-MHC-пентамеров у добровольцев, вакцинированных «КомбиВИЧвак» .

Задачи исследования:

1. Получить ДНК-вакцинные конструкции, кодирующие полиэпитопные Т-клеточные ВИЧ-1 иммуногены, разработанные с использованием различных стратегий проектирования, и подтвердить экспрессию продуктов целевых генов in vitro .

2. Исследовать способность полученных ДНК-вакцинных конструкций стимулировать ВИЧ-специфические ответы CD4+ и CD8+ Т-лимфоцитов у мышей линии BALB/c .





3. Провести сравнительное исследование иммуногенности ДНК-вакцинных конструкций и определить, какой из полиэпитопных иммуногенов индуцирует наиболее высокие уровни ВИЧ-специфических ответов CD4+ и CD8+ Т-лимфоцитов .

4. Изучить формирование Env- и Gag-специфических CD8+ Т-лимфоцитов с использованием пептид-МНС-пентамеров у вакцинированных добровольцев в рамках I фазы клинических испытаний вакцины «КомбиВИЧвак» .

Научная новизна работы В данной работе впервые в рамках одного исследования получены ДНК-вакцинные конструкции, кодирующие полиэпитопные ВИЧ-1 иммуногены TСI-N, TСI-N2 и TСI-N3, спроектированные с учетом особенностей процессинга и презентации Т-клеточных антигенов по пути MHC I и MHC II классов, а также проведено сравнительное исследование их специфической активности .

Подтверждено, что добавление сигнальных последовательностей, а именно N-концевого убиквитина (в составе TСI-N3) или N-концевой сигнальной последовательности белка E3/gp19K аденовирусов и С-концевого тирозинового мотива LAMP-1 (в составе TСI-N2) к последовательности Т-клеточного иммуногена (TСI-N) повышает уровень антиген-специфического CD4+ и CD8+ Т-клеточного иммунного ответа. В данном исследовании впервые было показано, что полиэпитопная конструкция TСI-N3, содержащая N-концевой убиквитин, является наиболее эффективной, так как индуцирует наиболее высокий уровень CD4+ и CD8+ Т-лимфоцитов, продуцирующих IL-2 и IFN .

Впервые использована методика пептид-МНС-пентамеров для определения количества антиген-специфических Т-лимфоцитов в рамках I фазы клинических испытаний вакцины против ВИЧ. Показано, что после иммунизации вакциной «КомбиВИЧвак» у добровольцев формируются ВИЧ-1 Env- и Gag-специфические CD8+ Т-лимфоциты. Это говорит в пользу рациональности использования полиэпитопных иммуногенов в составе вакцин для индукции вирус-специфического клеточного иммунного ответа .

Теоретическая и практическая значимость работы На основе новейших литературных данных предложены различные стратегии дизайна полиэпитопных Т-клеточных иммуногенов – прототипов для использования в качестве ДНК-вакцин против ВИЧ-1. Выявлены возможные способы повышения иммуногенности полиэпитопных конструкций путем оптимизации структуры ВИЧ-1 иммуногенов, а также с помощью дополнительных N- и С-концевых сигнальных последовательностей, увеличивающих уровень процессинга и презентации выбранных эпитопов CD4+ и CD8+ Т-лимфоцитам .

Полученные данные позволят усовершенствовать методы дизайна искусственных полиэпитопных иммуногенов для индукции ВИЧ-специфического Т-клеточного ответа, а также могут быть использованы в качестве стратегий повышения иммуногенности ДНК-вакцин против ряда патогенов человека и животных .

Положения, выносимые на защиту

1. ДНК-вакцинные конструкции, разработанные с использованием различных стратегий проектирования Т-клеточных иммуногенов, обеспечивают экспрессию генов, кодирующих полиэпитопные белки TСI-N, TСI-N2 и TСI-N3, и способны индуцировать ВИЧ-специфические ответы IFN- и IL-2-продуцирующих CD4+ и CD8+ Т-лимфоцитов у иммунизированных мышей линии BALB/c .

2. Использование N- и C-концевых сигнальных последовательностей – N-концевого убиквитина или N-концевой сигнальной последовательности белка E3/gp19K аденовирусов и С-концевого тирозинового мотива LAMP-1, способствующих процессингу и презентации эпитопов по пути MHC I и MHC II класса, – приводит к повышению иммуногенности спроектированных ДНК-вакцинных конструкций .

3. Убиквитин-зависимое нацеливание полиэпитопной конструкции на протеасому является более перспективной стратегией повышения ее иммуногенности по сравнению с нацеливанием на лизосому с помощью N-концевой сигнальной последовательности белка E3/gp19K аденовирусов в сочетании с тирозиновым мотивом LAMP-1 .

4. Вакцина «КомбиВИЧвак» индуцирует формирование Env- и Gagспецифических CD8+ Т-лимфоцитов у добровольцев на I фазе клинических испытаний .

Апробация и публикации По результатам работы опубликованы 4 статьи в журналах из списка ВАК, рекомендованных для защиты диссертаций. Также материалы работы были представлены на всероссийских и международных конференциях, по итогам которых опубликовано 12 тезисов .

Вклад автора Все основные эксперименты, включая наработку препаративного количества рекомбинантных плазмид, кодирующих полиэпитопные иммуногены TСI-N, TСI-N2 и TСI-N3, их очистку и дальнейшее изучение экспрессии целевых генов in vitro, а также иммунизацию лабораторных животных сконструированными ДНК-вакцинными конструкциями и анализ клеточных образцов на проточном цитофлуориметре для исследования способности CD4+ и CD8+ T-лимфоцитов продуцировать IL-2 и IFN, выполнены автором лично. Дизайн аминокислотной последовательности полиэпитопных Т-клеточных иммуногенов был выполнен в теоретическом отделе ФБУН ГНЦ ВБ «Вектор» канд. биол. наук Антонцом Д.В .

Конструирование рекомбинантных плазмид, кодирующих полиэпитопные иммуногены, было проведено совместно с канд. биол. наук Максютовым Р.А .

Исследование формирования ВИЧ-1 Env- и Gag-специфических CD8+ Т-лимфоцитов с помощью пептид-МНС-пентамеров у HLA A*0201-позитивных добровольцев в рамках I фазы клинических испытаний вакцины «КомбиВИЧвак», в том числе разработка протокола, проводилась автором лично. Статистический анализ данных выполнен совместно с канд. биол. наук Антонцом Д.В. в ФБУН ГНЦ ВБ «Вектор» .

Объем и структура диссертации Диссертация состоит из введения, обзора литературы, описания материалов и методов, результатов работы и их обсуждения, заключения, выводов и списка литературы. Работа изложена на 150 страницах текста, содержит 20 рисунков и 8 таблиц. Список литературы состоит из 310 ссылок .

МАТЕРИАЛЫ И МЕТОДЫ ИССЛЕДОВАНИЯ

Для выполнения представленной работы был применен широкий спектр методов: работа с нуклеиновыми кислотами (клонирование ДНК, конструирование рекомбинантных плазмид, их наработка в системе E .
coli и очистка рекомбинантных плазмид); оценка экспрессии генов in vitro с использованием эукариотических клеток (трансформация и культивирование), анализ белков (вестерн-блот, внутриклеточная детекция белков с использованием флуоресцентномеченых моноклональных антител), работа с лабораторными животными (иммунизация, выделение спленоцитов), изучение клеточного иммунного ответа и стимуляция спленоцитов, иммунофлуоресцентное (культивирование окрашивание клеток, внутриклеточное окрашивание цитокинов, проточная цитометрия), работа с периферическими мононуклеарными клетками крови человека (иммунофлуоресцентное окрашивание клеток, окрашивание пептидМНС-пентамерами) .

РЕЗУЛЬТАТЫ ИССЛЕДОВАНИЯ И ИХ ОБСУЖДЕНИЕ

Проектирование искусственных полиэпитопных Т-клеточных ВИЧ-1 иммуногенов TСI-N, TСI-N2 и TСI-N3. Дизайн нескольких вариантов новых полиэпитопных ВИЧ-1 иммуногенов – TСI-N, TСI-N2 и TСI-N3 – был проведен с учетом оптимизации экспрессии, процессинга и представления иммунной системе CD4+ и CD8+ Т-клеточных эпитопов. Предсказание Т-клеточных эпитопов и дизайн аминокислотной последовательности иммуногенов осуществляли с использованием программного обеспечения TEpredict и PolyCTLDesigner (Antonets and Bazhan, 2013; http://tepredict.sourceforge.net/PolyCTLDesigner.html). При этом были выбраны консервативные T-клеточные эпитопы в последовательностях белков ВИЧ-1 Env, Gag, Pol, Nef и Tat. Выбор проводился из списка экспериментально верифицированных CD8+ и CD4+ Т-клеточных эпитопов, представленных в HIV molecular immunology database (http://www.hiv.lanl.gov/ Общая стратегия content/immunology/tables/optimal_ctl_summary.html) .

проектирования целевых иммуногенов представлена на рисунке 1 .

С целью повышения иммуногенности полиэпитопных конструкций в их структуру были включены дополнительные последовательности:

o N-концевой убиквитин (Ub):

MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLS

DYNIQKESTLHLVLRLRGV76;

сигнальный пептид – (в нашем случае o N-концевой ER-signal MRYMILGLLALAAVCSAA – сигнальная последовательность белка E3/gp19K аденовирусов);

o С-концевой тирозиновый мотив LAMP-1 (RKRSHAGYQTI) .

Рисунок 1. Общая стратегия проектирования целевых Т-клеточных иммуногенов

Согласно предложенному дизайну N- и C-концевые последовательности использовались в трех различных комбинациях. В результате были спроектированы целевые последовательности трех Т-клеточных иммуногенов – TCI-N, TCI-N2 и TCI-N3, обеспечивающих презентацию целевых эпитопов в составе белка рolyE CD8+ и CD4+ Т-лимфоцитам по пути МНС I и МНС II классов (рис. 2) .

Первая конструкция TCI-N (или polyE) не содержит концевых сигнальных последовательностей и кодирует только «коровую» последовательность polyE .

Вторая конструкция TCI-N2 (или ER-signal_polyE_LAMP-1) была спроектирована таким образом, чтобы обеспечить нацеливание polyE иммуногена в лизосому для его процессинга и презентации по пути MHC II класса (Wu et al., 1995; de Arruda et al., 2004). В данном случае для фланкирования полиэпитопной конструкции TCI-N2 использовали две последовательности – N-концевой сигнальный пептид (ER-signal) и С-концевой тирозиновый мотив LAMP-1 .

LAMP-мотив направляет этот иммуноген из секреторного пути на деградацию в лизосомы, где образующиеся пептидные фрагменты связываются с молекулами МНС II класса и затем представляются на поверхности антиген-презентирующей клетки (АПК) CD4+ T-лимфоцитам .

Третья конструкция TCI-N3 (Ub_polyE), содержащая N-концевой убиквитин, нацеливает полиэпитопный иммуноген polyE в протеасому для его процессинга по убиквитин-зависимому пути для усиления ответов CD8+ ЦТЛ .

–  –  –

Конструирование рекомбинантных плазмид, кодирующих полиэпитопные Т-клеточные иммуногены. Для дизайна последовательностей синтетических генов TCI-N, TCI-N2 и TCI-N3 использовалась программа «GeneDesigner», позволяющая оптимизировать последовательности генов для их высокой экспрессии в клетках человека. На 5'-конце перед инициирующим кодоном ATG добавлена последовательность Kozak (CCGCCACC). В конце кодирующих последовательностей размещены три стоп-кодона (TAGTGATGA) .

Синтез генов, кодирующих полиэпитопные иммуногены TCI-N (polyE), TCI-N2 (ER-signal_polyE_LAMP-1) и TCI-N3 (Ub_polyE), осуществлен химикоферментативным способом в ЗАО «Евроген». Далее целевые гены были клонированы в составе плазмидного вектора pcDNA3.1/Myc-His(+)/lacZ (Invitrogen, США) (далее pcDNA3.1) по сайтам рестрикции HindIII и XhoI.

В результате были получены три целевые рекомбинантные плазмиды:

р1:pcDNA_Kozak_polyE(TCI-N);

р2:pcDNA_Kozak_ER-signal_polyE_LAMP-1(TCI-N2);

р3: pcDNA_Kozak_Ub_polyE(TCI-N3) .

Правильность полученных трех целевых генных конструкций p1, p2 и p3 в составе плазмиды pcDNA3.1 подтверждена секвенированием по обеим цепям .

Клетки E. coli BL21 были трансформированы плазмидами p1, p2 и p3, кодирующими полиэпитопные белки TCI-N, TCI-N2 и TCI-N3. Этот штамм E. coli обеспечивал наибольший выход плазмидной ДНК. Были наработаны препаративные количества рекомбинантных плазмидных ДНК, используемых в дальнейшем для трансфекции эукариотических клеток и иммунизации лабораторных животных .

Изучение экспрессии целевых генов в клетках 293Т, трансфицированных рекомбинантными плазмидами. Для оценки экспрессии целевых генов in vitro проводили трансфекцию клеток 293Т рекомбинантными плазмидами р1, р2 и р3 .

Через 48 ч после трансфекции исследовали продукцию полиэпитопных белков. В вестерн-блот анализе с использованием МКА 29F2 к Gag-эпитопу-маркеру, включенному в состав всех исследуемых белков, были обнаружены специфичные белковые фрагменты преимущественно в области 14 кДа (рис. 3А). Полученные данные являются закономерными, поскольку полиэпитопные белки TCI-N, TCI-N2 и TCI-N3 содержат сайты протеолитического расщепления с использованием ферментативных систем клетки, что обеспечивает их процессинг, поэтому полноразмерные целевые белки являются нестабильными в клетке .

Подверженность полиэпитопных белков протеолитической деградации была подтверждена в прокариотической системе экспрессии E. coli. Для этого мы анализировали в иммуноблоттинге с использованием МКА 29F2 клеточные лизаты E. coli после трансформации плазмидой pGEX-4Т-TCI-N (плазмида получена от Баранова К.О., ИМКБ СО РАН), которая экспрессирует ген целевого белка TCI-N polyE под прокариотическим промотором. При этом были выявлены дискретные специфические белковые фрагменты различной молекулярной массы (рис. 3Б) .

Для доказательства экспрессии целевых генов был также применен высокочувствительный метод внутриклеточной детекции полиэпитопных белков на основе проточной цитометрии. Для этого клетки 293Т, трансфицированные плазмидами р1, р2 и р3, фиксировали с последующей пермеабилизацией мембраны с использованием набора Cytofix/Cytoperm™ Plus Fixation/Permeabilization Kit (BD, США). Это позволяло FITC-меченым МКА 29F2 проникать внутрь клетки и специфически связываться с содержащимся в составе целевых иммуногенов TCI-N, TCI-N2 и TCI-N3 Gag-эпитопом .

–  –  –

Рисунок 3. Вестерн-блот анализ продуктов экспрессии генов, кодирующих полиэпитопные белки TCI-N, TCI-N2 и TCI-N3 .

А) Дорожки 1, 2, 3 содержат лизаты клеток 293Т, трансфицированных плазмидами р1, р2 и р3; 4 – отрицательный контрольный образец, представляющий лизат клеток 293Т, трансфицированных исходным вектором pcDNA3.1.; стрелками указан молекулярный вес белков; снизу представлен контроль количества клеток с использованием антител к -актину. Б) Дорожка 1 содержит лизат клеток E. coli, трансформированных плазмидой pGEX-4Т-TCI-N; Дорожка 2 содержит лизат клеток E. coli без трансформации; M – маркер молекулярной массы белков Рисунок 4. Внутриклеточная детекция полиэпитопных белков TCI-N, TCI-N2 и TCI-N3 с помощью МКА 29F2, меченых FITC. А) Гейтирование клеток 293Т; Б), В), Г), Д) Гистограммы, отражающие степень интенсивности свечения по FL1 окрашенных антителами 29F2-FITC клеток 293Т, трансфицированных плазмидами pcDNA3.1, р1, р2 и р3 и содержащих Gag-эпитоп-маркер. M1 – область специфической флуоресценции, демонстрирующая наличие Gag-эпитопа-маркера в эукариотических клетках, с которым специфически связываются антитела При анализе клеточных образцов на проточном цитометре BD FACSCalibur был зарегистрирован пик специфической флуоресценции в области положительных значений по сравнению с отрицательным контрольным образцом (рис. 4) .

Иммунизация лабораторных животных сконструированными ДНК-вакцинными конструкциями и сбор образцов. Иммуногенность полученных ДНК-вакцинных конструкций была исследована на модели лабораторных мышей инбредной линии BALB/c. Группы мышей (N = 30) иммунизировали рекомбинантными плазмидами р1, р2 и р3 на 0-й, 28-й и 56-й дни .

В качестве отрицательного контроля для иммунизации мышей (N = 7) использовали векторную плазмиду pcDNA3.1. В качестве положительного контроля для иммунизации мышей (N = 30) использовали плазмиду pcDNA-TCI – компонент вакцины «КомбиВИЧвак» (Bazhan et al., 2004, 2008; Karpenko et al., 2004, 2007). Для исследования клеточного иммунного ответа проводили забой части иммунизированных животных (N = 10) в каждой группе: на 14-й, 35-й и 72-й эксперимента с целью получения клеточных образцов .

Изучение способности искусственных полиэпитопных иммуногенов TCI-N, TCI-N2 и TCI-N3 стимулировать ВИЧ-специфические ответы CD4+ и CD8+ Т-лимфоцитов. В качестве ключевых параметров для сравнительного исследования иммуногенности полиэпитопных конструкций было установление способности CD4+ и CD8+ T-лимфоцитов продуцировать IL-2 и IFN .

IL-2 и IFN – ключевые цитокины, которые, как предполагается, связаны с контролем ВИЧ-инфекции (Akinsiku et al., 2011; Reuter et al., 2012). Определение количества CD4+ и CD8+ T-клеток, продуцирующих IL-2 и IFN, была изучена с помощью метода внутриклеточного окрашивания цитокинов после in vitro стимуляции спленоцитов, выделенных у иммунизированных животных, смесью синтетических пептидов, соответствующих эпитопам ВИЧ-1: AMQMLKETI (p24), IFQSSMTKI (RT), FEPFRDYVDR (p24), VYYDPSKDLI (RT), SYHRLRDFI (gp160), SLYNTVATL (p17). Последовательности пептидов являются точными копиями последовательностей эпитопов, входящих в состав целевых иммуногенов. Анализ клеточных образцов осуществляли на проточном цитометре BD FACSCalibur .

Результаты статистической обработки этих данных приведены на рис. 5 – 8 .

После каждой иммунизации рекомбинантными плазмидами р1, р2 и р3 в группах мышей уровни IL-2- и IFN-продуцирующих CD4+ и CD8+ T-лимфоцитов были достоверно выше, чем в отрицательной контрольной группе животных, которым вводили векторную плазмиду pcDNA3.1 (P 0,05) (рис. 5 – 8) .

–  –  –

Выбор наиболее эффективной ДНК-вакцинной конструкции, стимулирующей наибольший уровень ВИЧ-специфического CD4+ и CD8+ Т-клеточного ответа. Согласно данным, представленным на рисунках 5 – 8, плазмида р3, кодирующая иммуноген TCI-N3 (Ub_polyE), достоверно индуцирует наибольший уровень IL-2- и IFN-продуцирующих CD4+ и CD8+ Т-лимфоцитов по сравнению с иммуногенами TCI-N (polyE) и TCI-N2 (ER-signal_polyE_LAMP-1) после трехкратной иммунизации (Р 0,05). Полученные результаты позволяют сделать вывод, что убиквитин-зависимое нацеливание полиэпитопного белка на протеасому является предпочтительным, так как оно обеспечивает более выраженный ответ как CD8+, так и CD4+ Т-лимфоцитов. Усиление CD8+ Т-клеточного ответа, вероятнее всего, происходит за счет повышения презентации эндогенно синтезируемого антигена по пути MHC I класса в результате убиквитинзависимой протеасомной деградации (Bauer et al .


, 2006), а более эффективная стимуляция CD4+ Т-клеточного ответа, вероятно, – за счет механизма, который обеспечивает переключение презентации антигена с MHC-I на MHC-II путь. Этот механизм был описан в литературе как «утечка», в результате чего часть антигена может высвобождаться в составе аутофагосомы и транспортироваться из цитоплазмы в лизосому по пути MHC II класса (Leitner and Restifo, 2003; Schmid et al., 2007). В результате происходит индукция CD4+ Т-лимфоцитов, которые, как известно, усиливают ответы CD8+ ЦТЛ .

Способны ли предложенные стратегии оптимизации структуры искусственных иммуногенов усилить Т-клеточные ответы по сравнению с неоптимизированными антигенами? Для сравнения в качестве неоптимизированного антигена был выбран иммуноген TCI, кодируемый в составе рекомбинантной плазмиды pcDNA-TCI, являющейся компонентом вакцины «КомбиВИЧвак» (Bazhan et al., 2004, 2008; Karpenko et al., 2004, 2007). Согласно полученным результатам (рис. 9), среди трех оптимизированных конструкций – TСI-N, TСI-N2, TСI-N3 – только одна, а именно TCI-N3 (Ub_polyE), оказалась более иммуногенной в отношении индукции ВИЧ-специфических IL-2- и IFNпродуцирующих CD4+ Т-лимфоцитов, а также IL-2-продуцирующих CD8+ Т-лимфоцитов по сравнению с неоптимизированным иммуногеном TCI (P 0.05) .

Хотя положительный эффект был достигнут только после третьей иммунизации, полученные результаты позволяют говорить о том, что путем оптимизации структуры иммуногена можно получить вакцину, которая по иммуногенности будет превосходить вакцины, полученные на основе нативных антигенов .

–  –  –

В Г Рисунок 9. Количество IL-2- и IFN-продуцирующих Т-лимфоцитов в каждой группе опытных животных после каждой иммунизации (P 0.05). A) – количество IL-2-продуцирующих CD4+ Т-лимфоцитов; Б) – количество IL-2-продуцирующих CD8+ Т-лимфоцитов;

В) – количество IFN-продуцирующих CD4+ Т-лимфоцитов; Г) – количество IFN-продуцирующих CD8+ Т-лимфоцитов. Уровни цитокинпродуцирующих T-лимфоцитов (в % от общего количества CD4+ или CD8+ Т-лимфоцитов) показаны на оси Y. Различные сроки забора клеточных образцов у иммунизированных животных отображены на оси Х Исследование формирования ВИЧ-специфических CD8+ Т-лимфоцитов у добровольцев, иммунизированных вакциной «КомбиВИЧвак». Иммуногенность вакцины «КомбиВИЧвак», в том числе ДНК-компонента была продемонстрирована на этапе pcDNA-TCI, доклинических испытаний на модели мышей (Bazhan et al., 2004, 2008; Karpenko et al., 2004, 2007). Однако использование мышиной модели не является оптимальной из-за различий в степени связывания Т-клеточного рецептора с комплексом МНС-пептид на поверхности АПК. В данном исследовании стояла цель оценить презентацию выбранных эпитопов, входящих в структуру Т-клеточного иммуногена TCI, в составе человеческих молекул НLA, чтобы подтвердить, что выбранные эпитопы проходят правильный процессинг и представление Т-лимфоцитам in vivo, в результате чего формируются ВИЧ-специфические CD8+ ЦТЛ. Это было реализовано в рамках I фазы клинических испытаний «КомбиВИЧвак» с использованием МНС-пентамеров в комплексе с пептидами ВИЧ-1 Env- и Gag- и проточной цитометрии .

Описание вакцины и клинических испытаний.

Комбинированная вакцина «КомбиВИЧвак» объединяет два полиэпитопных иммуногена:

полиэпитопный белок TBI стимулирует образование ВИЧ-специфического гуморального ответа; полиэпитопный белок TCI, кодируемый ДНК-вакциной (плазмида pcDNA-TCI), направлен на формирование ВИЧ-специфических CD4+ и CD8+ Т-лимфоцитов (Karpenko et al., 2004; 2007). Вакцина «КомбиВИЧвак»

прошла доклинические испытания, экспертизу в ФГБУ «ГИСК им. Тарасевича Л.А.» Минздравсоцразвития России и получила разрешение Росздравнадзора на проведение первой фазы клинических исследований (Регистрационный номер – RegNx 123539 RegWorkNx: 61708 ФГУ НЦЭСМП Росздравнадзора). Данное исследование было одобрено Комитетом по этике Минздрава РФ. Все добровольцы подписали информированное согласие для их участия в испытании. Тест с использованием пептид-МНС-пентамеров был включен в список разрешенных Росздравнадзором исследований в рамках I фазы клинических испытаний «КомбиВИЧвак». Добровольцы методом случайного выбора были распределены на 2 группы: опытная группа 1 (15 добровольцев) была привита вакциной «КомбиВИЧвак» однократно, опытная группа 2 (15 добровольцев) привита вакциной «КомбиВИЧвак» двукратно с интервалом 28 дней .

Методика пептид-МНС-пентамеров была впервые использована в рамках исследования Т-клеточного ответа в клинических испытаниях вакцин, проводимых в России, она потребовала особого внимания и отработки протокола в условиях эксперимента. На этом основании данный раздел явился отдельной исследовательской работой .

Определение и у Env- Gag-специфических CD8+ T-лимфоцитов добровольцев, вакцинированных HLA A*0201-позитивных «КомбиВИЧвак». Для выполнения этой задачи были использованы коммерчески доступные Pro5 MHC-пентамеры I класса в комплексе с пептидами ВИЧ-1 Env D1 (KLTPLCVTL aa 120-128) и Gag 17A (SLYNTVATL aa 77-85) в сочетании с флуоресцентно мечеными анти-CD8 МКА (ProImmune, Великобритания). Пептид-МНС-пентамеры характеризуются HLAспецифичностью, в связи с этим мы использовали MHC-пентамеры, специфичные к наиболее распространенному в человеческой популяции HLA аллелю класса В результате предварительного

– I HLA A*0201 .

HLA-генотипирования в группе добровольцев, вакцинированных однократно, генотипом HLA A*02 обладали шесть человек, в группе добровольцев, вакцинированных двукратно, – шесть человек. На протяжении исследования в крови иммунизированных «КомбиВИЧвак» добровольцев были обнаружены CD8+ Т-лимфоциты, специфичные к Env- и Gag-эпитопам ВИЧ-1 (табл. 1, 2) .

Фоновый уровень пентамер-специфических CD8+ T-клеток у исследуемых участников испытаний составил 0,1% от общего количества CD8+ Т-лимфоцитов перед началом вакцинации .

Наибольшее количество Env-специфических CD8+ Т-клеток было зарегистрировано у всех исследуемых добровольцев (100 %) на 14-й день после введения вакцины как в группе с однократной вакцинацией (1,05 % от числа CD8+ Т-клеток), так и с двухкратной (1,7 % от числа CD8+ Т-клеток) и было достоверно выше фонового уровня до вакцинации (Р 0,01), после чего постепенно снижалось (табл .

1, 2; рис. 10, 11). Повторная вакцинация «КомбиВИЧвак» стимулировала достоверное повышение медианного значения KLTPLCVTL+ CD8+ Т-клеток через полгода после начала эксперимента по сравнению с их количеством в группе однократно вакцинированных (Р 0,01) (табл. 1, 2; рис. 10, 11). После 6 месяцев количество Еnv-специфических CD8+ Т-лимфоцитов падает до фонового уровня (0,1 %), однако практически у всех исследуемых добровольцев из обеих групп детектируются единичные KLTPLCVTL+ CD8+ Т-клетки (табл. 1, 2), которые, вероятно, являются Т-клетками памяти, а большая часть невостребованных CD8+ KLTPLCVTL+ Т-лимфоцитов, возможно, подвергается апоптозу .

–  –  –

1/3 2 (0) 128 (0,9) 7 (0) 118 (0,6) 0 (0) 4 (0,2) 1 (0) 15 (0,2) 14 (0,2) 13 (0,2) 0 (0) 5 (0,1) 1/7 3 (0) 273 (1,3) 2 (0) 76 (0,3) 0 (0) 8 (0,2) 2 (0) 22 (0,2) 6 (0,1) 8 (0,1) 0 (0) 4 (0,1) 1/9 0 (0) 23 (0,6) 2 (0) 113 (0,7) 0 (0) 25 (0,3) 3 (0) 21 (0,2) 1 (0,1) 9 (0,3) 0 (0) 7 (0,1)

–  –  –

Рисунок 10. Процент KLTPLCVTL+ CD8+ Т-лимфоцитов среди всех CD8+ Т-лимфоцитов после однократной вакцинации. % KLTPLCVTL+ CD8+ Т-клеток показаны на оси Y. Сроки после вакцинации, на которые проводили замер, отображены на оси Х Gag-специфические CD8+ Т-лимфоциты были обнаружены у семи из двенадцати (58 %) вакцинированных «КомбиВИЧвак» участников на протяжении I фазы клинических испытаний. SLYNTVATL+ CD8+ Т-клетки появляются на низких уровнях у всех добровольцев в группе с однократной вакцинацией на 6-й или 9-й месяц испытания, но лишь у 50 % участников количество этих клеток превышает фоновый уровень (0,2 % – 0,5 %) (табл. 1) .

–  –  –

Рисунок 11. Процент KLTPLCVTL+ CD8+Т-лимфоцитов среди всех CD8+ Т-лимфоцитов после двукратной вакцинации. % KLTPLCVTL+ CD8+ Т-клеток показаны на оси Y. Сроки после вакцинации, на которые проводили замер, отображены на оси Х В группе двукратно вакцинированных SLYNTVATL+ CD8+ Т-лимфоциты определяются в количестве 0,2 % у одного из шести добровольцев на 28-й день от начала клинических испытаний (табл. 2). Вторая иммунизация «КомбиВИЧвак» стимулировала образование Gag-специфических CD8+ Т-лимфоцитов на уровнях, отличающихся от фонового, у двух из шести добровольцев (33,4 %) на 28-й день после повторного введения вакцины (табл. 2). В последующем SLYNTVATL+ CD8+ Т-лимфоциты определяются у одного из добровольцев в группе с двукратной вакцинацией на 3-й месяц (0,3 %), двух добровольцев из этой же группы на 6-й месяц (0,1 % и 0,5 %), и у одного – на 9-й месяц (0,2 %) от начала клинических исследований (табл. 2) .

Через год от начала эксперимента SLYNTVATL+ CD8+ Т-лимфоциты не обнаружены у участников в обеих группах, вакцинированных «КомбиВИЧвак»

(табл. 1, 2) .

В заключение следует отметить, что присутствие ВИЧ-1 Env- и Gagспецифических CD8+ Т-лимфоцитов в крови иммунизированных добровольцев на разных сроках I фазы клинических испытаний вакцины «КомбиВИЧвак»

свидетельствует о том, что эпитопы белков ВИЧ-1 Env (KLTPLCVTL) и Gag (SLYNTVATL) в составе иммуногена TCI проходят правильный процессинг и презентацию CD8+ Т-лимфоцитам, обеспечивая формирование ВИЧ-специфических CD8+ Т-клеток .

ВЫВОДЫ

Получены ДНК-вакцинные конструкции, кодирующие 1 .

искусственные полиэпитопные Т-клеточные ВИЧ-1 иммуногены TСI-N, TСI-N2 и TСI-N3, спроектированные с учетом особенностей процессинга и презентации Т-клеточных антигенов. TСI-N представляет собой полиэпитопный фрагмент (общий для всех иммуногенов), в составе которого порядок эпитопов и спейсерные последовательности оптимизированы, как для протеасомного расщепления, так и для связывания эпитопов с TAP. В составе иммуногена TСI-N2 полиэпитопный фрагмент содержит N-концевую сигнальную последовательность белка E3/gp19K аденовирусов и С-концевой тирозиновый мотив LAMP-1, а в составе иммуногена TСI-N3 – N-концевой убиквитин .

Полученные ДНК-вакцинные конструкции обеспечивают 2 .

экспрессию генов, кодирующих целевые иммуногены TСI-N, TСI-N2 и TСI-N3 in vitro, а также вызывают статистически значимые (P 0,05) ответы ВИЧ-специфических CD4+ и CD8+ Т-лимфоцитов, продуцирующих IFN- и IL-2 у мышей линии BALB/c .

Показано, что присоединение N-концевого убиквитина (в составе 3 .

TСI-N3) или N-концевой сигнальной последовательности белка E3/gp19K аденовирусов и С-концевого тирозинового мотива LAMP-1 (в составе TСI-N2) к последовательности полиэпитопного иммуногена (TСI-N) вызывает статистически значимое (P 0,05) повышение ВИЧ-специфических ответов CD4+ и CD8+Т-лимфоцитов, продуцирующих IFN и IL-2, по сравнению с полиэпитопным иммуногеном TСI-N, не содержащим дополнительных сигнальных последовательностей .

Выявлено, что ДНК-вакцинная конструкция, кодирующая 4 .

иммуноген TCI-N3, содержащий N-концевой убиквитин, индуцирует наиболее высокие статистически значимые (P 0,05) уровни IFN- и IL-2-продуцирующих CD4+ и CD8+ Т-лимфоцитов после трехкратной иммунизации по сравнению с конструкциями, кодирующими иммуногены TСI-N и TСI-N2 .

С помощью пептид-МНС-пентамеров в рамках I фазы клинических 5 .

испытаний вакцины «КомбиВИЧвак» показано формирование (KLTPLCVTL) CD8+ Т-лимфоцитов у 100 % и Env-специфических Gag-специфических (SLYNTVATL) CD8+ Т-лимфоцитов у 50 % HLA-A*0201позитивных добровольцев .

СПИСОК РАБОТ, ОПУБЛИКОВАННЫХ

ПО ТЕМЕ ДИССЕРТАЦИИ

Статьи в журналахиз списка ВАК, рекомендованных для защиты диссертаций:

1. Карпенко Л.И., Мечетина Л.В., Регузова А.Ю. MHC-мультимеры и их применение в изучении противовирусного иммунного ответа // Журн .

микробиологии, эпидемиологии и иммунобиологии. – 2011. – № 2. – С. 112 – 119 .

2. Регузова А.Ю., Антонец Д.В., Максютов Р.А., Волкова О.Ю., Карпенко Л.И., Ильичев А.А., Бажан С.И. Дизайн, конструирование и оценка экспрессии генов, кодирующих полиэпитопные Т-клеточные иммуногены ВИЧ-1 в составе ДНК-вакцинных конструкций // Вестник НГУ. – 2013. – № 2. – С. 5 – 12 .

3. Reguzova A.Y., Karpenko L.I., Mechetina L.V., Belyakov I.M. Peptide-MHC multimer-based monitoring of CD8 T-cells in HIV-1 infection and AIDS vaccine development // Expert Rev. Vaccines. – 2015. – V. 14. – N. 1. – P. 69 – 84 .

4. Reguzova A., Antonets D., Karpenko L., Ilyichev A., Maksyutov R., Bazhan S .

Design and evaluation of optimized artificial HIV-1 poly-T cell-epitope immunogens // PLOS ONE. – 2015. – V. 10. – N. 3. – P. e0116412 .

Тезисы на всероссийских и международных конференциях:

1. Регузова А.Ю., Антонец Д.В., Максютов Р.А., Бажан С.И., Карпенко Л.И .

Конструирование и биологическое тестирование ДНК-вакцинных конструкций, кодирующих структурные варианты искусственного полиCTL-эпитопного иммуногена ВИЧ-1. Материалы Третьей Конференции по вопросам ВИЧ/СПИДа в Восточной Европе и Центральной Азии EECAAC 2009, 28 – 30 октября 2009, Москва, Россия. – С. 125 .

2. Бажан С.И., Карпенко Л.И., Антонец Д.В., Регузова А.Ю., Максютов Р.А., Ильичев А.А. Рациональный дизайн новых полиэпитопных ДНК-вакцин для индукции ответа CD8+ Т-лимфоцитов против ВИЧ-1. Материалы рабочего совещания по рассмотрению итогов выполнения распоряжения правительства РФ от 25.12.2007 г. № 1905-р., 17 – 19 ноября 2010, Новосибирск, Россия. – С. 160 – 168 .

3. Регузова А.Ю., Антонец Д.В., Максютов Р.А., Бажан С.И., Карпенко Л.И .

Конструирование и биологическое тестирование ДНК-вакцины, кодирующей оптимизированные поли-CTL-эпитопные ВИЧ-1 иммуногены. Материалы Всероссийской научно-практической конференции с международным участием «Дни иммунологии в Сибири», 1 – 3 марта 2010, Красноярск, Россия. – С. 197 – 198 .

4. Карпенко Л.И., Исаков И.В., Шакина Н.А., Регузова А.Ю., Ильичев А.А .

Разработка метода оценки специфической активности кандидатной вакцины против ВИЧ-1 с помощью техники МНС-тетрамеров. Всероссийская научнопрактическая конференция с международным участием «Дни иммунологии в Сибири», 27–29 апреля 2011, Абакан, Россия. – С.172 – 173 .

5. Регузова А.Ю., Антонец Д.В., Максютов А.З., Бажан С.И., Карпенко Л.И .

Изучение биологических и иммунологических свойств оптимизированных искусственных Т-клеточных ВИЧ-1 иммуногенов. III Ежегодный Всероссийский Конгресс по инфекционным болезням, 28 – 30 марта 2011, Москва, Россия. – С. 309 .

6. Karpenko L.I., Reguzova A.Yu., Starostina E.V., Borobova E.A., Antonets D.V., Ilyichev A.A., Bazhan S.I. Аrtificial poly-CTL-epitopes DNA vaccines. The 8th International Conference on the Bioinformatics of Genome Regulation and Structure/Systems Biology (ВGRS\SB-2012), 25 – 29 June 2012, Novosibirsk, Russia. – P. 87 .

7. Карпенко Л.И., Рындюк Н.Н., Гинько З.И., Кузубов В.И., Лебедев Л.Р., Богрянцева М.П., Каплина О.Н., Регузова А.Ю., Рыжиков А.Б., Усова С.В., Орешкова C.Ф., Масычева В.И., Нечаева Е.А., Ильичев А.А., Бажан С.И .

Результаты I фазы клинических испытаний кандидатной вакцины против ВИЧ-1 (КомбиВИЧвак). Материалы научно-практической конференции «Диагностика и профилактика инфекционных болезней», 26 – 28 сентября 2013, Новосибирск, Россия. – С. 186 – 187 .

8. Регузова А.Ю., Антонец Д.В., Максютов Р.А., Ильичев А.А., Орешкова С.Ф., Бажан С.И., Карпенко Л.И. Конструирование полиэпитопныхТклеточных ВИЧ-1 иммуногенов и исследование их биологической активности в составе ДНК-вакцины. I Международный Форум «Инновации в медицине: основные проблемы и пути их решения. Высокотехнологичная медицина как элемент новой инновационной экономики», 22 – 23 марта 2013 г., Новосибирск, Россия. – С. 248 – 255 .

9. Karpenko L.I., Ryndyuk N.N., Gin’ko Z.I., Kuzubov V.I., Bazhan S.I., Lebedev L.R., Kaplina O.N., Reguzova A.Yu., Ryzhikov A.B., Bogryantseva M.P., Usova S.V., Masycheva V.I., Nechaeva E.A., Ilyichev A.A. Phase I clinical trials of DNA-protein Vaccine (CombiHIVvac) Containing Artificial Multi-Clade Immunogens. International Conference «AIDS Vaccine 2013», 7 – 10 October 2013, Barcelona, Spain, OA03.02. – P. 61 .

10. Reguzova A.Yu., Antonets D.V., Maksyutov R.A., Karpenko L.I., Ilyichev A.A., Bazhan S.I. Design of artificial HIV-1 poly-CTL-epitope immunogens optimized for inducing CD8+ HIV-specific immune responses. 13th Young Scientist’s Forum (YSF), 3 – 6 July 2013, St. Petersburg, Russia. – P.128 .

11. Reguzova A.Yu., Antonets D.V., Maksyutov R.A., Karpenko L.I., Ilyichev A.А., Bazhan S.I. Design of artificial HIV-1 poly-CTL-epitope immunogens optimized for inducing CD8+ HIV-specific immune responses. Federation of European Biochemical Societies FEBS CONGRESS 2013 “Mechanisms in Biology”, 6 – 11 July 2013, St. Petersburg, Russia. – P.128 .

12. Reguzova A.Yu., Antonets D.V., Maksyutov R.A., Bazhan S.I., Karpenko L.I .

Optimized Poly-CTL-epitope HIV-1 Immunogens for Inducing CD8+ HIV-specific Immune Responses. International Conference «AIDS Vaccine 2013», 7 – 10 October 2013, Barcelona, Spain, P13.32. – P. 286 .






Похожие работы:

«Октябрь 2018 года CFS 2018/45/Inf.7 R КОМИТЕТ ПО ВСЕМИРНОЙ ПРОДОВОЛЬСТВЕННОЙ БЕЗОПАСНОСТИ Сорок пятая сессия Новый взгляд на продовольственную безопасность и питание Рим, Италия, 15–19 октября 2018 года ПРИВЕТСТВЕННОЕ СЛОВО ПРЕДСЕДАТЕЛЯ КВПБ Эта сорок пятая сессия КВПБ прохо...»

«МИКРОБИОЛОГИЯ © КОЛЛЕКТИВ АВТОРОВ, 2014 МИКРОБИОЦЕНОЗ ТОЛСТОГО КИШЕЧНИКА И СОДЕРЖАНИЕ СВОБОДНЫХ АМИНОКИСЛОТ В МИКРОБНО-ТКАНЕВОМ КОМПЛЕКСЕ КРЫС ШЕЙБАК В.М., НИКОЛАЕВА И.В., ПАВЛЮКОВЕЦ А.Ю. УО "Гродненский государственн...»

«Пояснительная записка При разработке учебного плана для 9 использовалась нормативноправовая база по реализации государственных образовательных стандартов общего образования 2004 года: Федеральный...»

«Фармацевтический рынок РОССИИ Выпуск: октябрь 2014 розничный аудит фармацевтического рынка РФ – октябрь 2014 события фармацевтического рынка – ноябрь 2014 Информация основана на данных розничного аудита фармацевти...»

«ПАРАЗИТОЛОГИЯ, XV, 5, 1981 УДК 576.895.122.1 НОВЫЕ ВИДЫ РОДА HORRICAUDA (MONOGENEA: МО NOCOTYLIDAE) Т. А. Тимофеева Зоологический институт АН СССР, Ленинград Дается описание четырех новых видов моногеней рода Horricauda, паразитирующид на жабрах скатов родов Rhynchobatus и Rhinobatos. При изучении материалов, собранных Б. Е. Быховским и JL Ф....»

«008742 Область техники Изобретение относится к молекулярной биологии. Более конкретно, изобретение относится к способам ПЦР в режиме реального времени и абсолютному количественному определению экспрессии генов. Уровень техники Основная технология ПЦР применяется для амплификации последовательности интересующей ДНК. При ПЦР с обратной транскрипт...»

«Северина Наталия Александровна "Анализ мутаций в генах TP53, NOTCH1, SF3B1 и BIRC3 у больных хроническим В-клеточным лимфолейкозом” 14.01.21 – Гематология и переливание крови Автореферат на соискание ученой степени кандидата био...»




 
2019 www.mash.dobrota.biz - «Бесплатная электронная библиотека - онлайн публикации»

Материалы этого сайта размещены для ознакомления, все права принадлежат их авторам.
Если Вы не согласны с тем, что Ваш материал размещён на этом сайте, пожалуйста, напишите нам, мы в течении 1-2 рабочих дней удалим его.